PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010919471.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 334aa    MW: 38754.6 Da    PI: 6.8385
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010919471.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1821.4e-5671361129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv++yL+kkv+++++el +vik+vd+yk+ePwdL++  k+   e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk++
  XP_010919471.1   7 VPPGFRFHPTDEELVDYYLRKKVASRRIEL-DVIKDVDLYKIEPWDLQErcKIGMeEQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKPI 100
                     69****************************.9***************963433333556************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +s k++l+g++ktLvfykgrap+g+k+dW+mheyrle
  XP_010919471.1 101 YS-KNNLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                     **.899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-625156IPR003441NAC domain
PROSITE profilePS5100560.8097156IPR003441NAC domain
PfamPF023659.1E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MNTFSHVPPG FRFHPTDEEL VDYYLRKKVA SRRIELDVIK DVDLYKIEPW DLQERCKIGM  60
EEQNEWYFFS HKDKKYPTGT RTNRATTAGF WKATGRDKPI YSKNNLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN GTPQEEGWVV CRVFKKKVTA IRRVSEHESP CWYDEQTSFM  180
PDLDSPKRIV PQPDMAYHQH LYSCKPDLEL HHLMPQDPFH QLPQLESPKL PNYVNHGCAL  240
QPSSVAPEDP MLPGHQLQFI SIYNCSGSND LSVEQVTDWR VLDKFVASQL SHDDVSKEPN  300
NSNSAQVFQV SDKEKAPVEY ASTSTSSGQI NLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-53615714169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010919471.10.0PREDICTED: NAC domain-containing protein 7
SwissprotQ9FWX21e-141NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A0G2UF560.0A0A0G2UF56_MUSPR; Vascular related NAC-domain protein 3
STRINGGSMUA_Achr11P17510_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-132NAC 007